PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00345g02002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 139aa    MW: 16140.5 Da    PI: 8.6998
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00345g02002.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF337.8e-111658244
                              ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
                    SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                              +i+ +  r++tfskR   + K A+EL   C++++ +i+fs+++
  Peinf101Scf00345g02002.1 16 KIKKEEDRYTTFSKRGSSLYKTASELASQCNVDIGIILFSPKD 58
                              7999999*********************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.75767IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-9766IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-18878IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-8929IPR002100Transcription factor, MADS-box
PfamPF003191.6E-151663IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-82944IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-84465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MEEKKTRGRQ KIPMEKIKKE EDRYTTFSKR GSSLYKTASE LASQCNVDIG IILFSPKDNP  60
FAFFHPIIEA VIDRFLDPHA QLSDTTRLVA VHVRNKVNEL NREIKELDKI EEATKKQALQ  120
YEKLKEHVCF DDATSRTTL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016474013.12e-53PREDICTED: agamous-like MADS-box protein AGL61
TrEMBLM1DXG33e-41M1DXG3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000959809e-41(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38220138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.14e-26AGAMOUS-like 61